PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009624781.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB
Protein Properties Length: 246aa    MW: 28369.4 Da    PI: 10.0146
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009624781.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding47.73.7e-151966148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+W++eEd++l+ ++ ++G  +W+  ++  g+ Rt+k+c++rw +yl
   XP_009624781.1 19 KGAWSPEEDQKLKSYIIRYGIWNWSHMPKFAGLSRTGKSCRLRWMNYL 66
                     79******************99************************97 PP

2Myb_DNA-binding47.73.6e-1572117148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g++T eE e+ +++ ++lG++ W+tIa++++ gR+++++k++++++l
   XP_009624781.1  72 KGPFTMEEREIVIKLYQELGSR-WSTIAAKLP-GRSDNDVKNFFYTHL 117
                      79********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129421.2631470IPR017930Myb domain
SuperFamilySSF466891.02E-2717113IPR009057Homeodomain-like
SMARTSM007178.4E-121868IPR001005SANT/Myb domain
PfamPF002492.4E-131966IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.1E-212073IPR009057Homeodomain-like
CDDcd001672.22E-92166No hitNo description
PROSITE profilePS5129415.7371121IPR017930Myb domain
SMARTSM007171.4E-1371119IPR001005SANT/Myb domain
PfamPF002493.6E-1372117IPR001005SANT/Myb domain
CDDcd001671.00E-874117No hitNo description
Gene3DG3DSA:1.10.10.602.1E-2374121IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 246 aa     Download sequence    Send to blast
MSSVPQHQQK STNMEEIKKG AWSPEEDQKL KSYIIRYGIW NWSHMPKFAG LSRTGKSCRL  60
RWMNYLRSDV KKGPFTMEER EIVIKLYQEL GSRWSTIAAK LPGRSDNDVK NFFYTHLKKH  120
MGMKNDALLK SKTRRKRVEK PQKSVGKINA EKAQERPVLF LAINNLTIGK SSNNSLTSPD  180
VSSSCSSSII TFGENQKMNI EMENTVILES NPEIYQSDCL SIESLDQFDT SSFWFHLLND  240
AHRLIL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C3e-23611914126MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009624781.10.0PREDICTED: transcription factor MYB82-like isoform X1
TrEMBLK4BIR53e-78K4BIR5_SOLLC; Uncharacterized protein
STRINGSolyc03g093890.2.18e-78(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G23250.13e-45myb domain protein 15